GLP2R Antikörper (N-Term)

Produktnummer ABIN634532

Produktdetails anti-GLP2R Antikörper

Target: GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLP2R Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLP2 R antibody was raised against the N terminal of GLP2

Aufreinigung: Affinity purified

Immunogen: GLP2 R antibody was raised using the N terminal of GLP2 corresponding to a region with amino acids KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLP2R Blocking Peptide, catalog no. 33R-4510, is also available for use as a blocking control in assays to test for specificity of this GLP2R antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLP2R

Target: GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))

Andere Bezeichnung: GLP2R (GLP2R Produkte)

Synonyme: 9530092J08Rik antikoerper, GLP-2 antikoerper, glucagon like peptide 2 receptor antikoerper, glucagon-like peptide 2 receptor antikoerper, GLP2R antikoerper, Glp2r antikoerper

Hintergrund: The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Feeding Behaviour