Selenoprotein S Antikörper (Middle Region)

Produktnummer ABIN634546

Produktdetails anti-Selenoprotein S Antikörper

Target: Selenoprotein S (SELS)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Selenoprotein S Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SELS antibody was raised against the middle region of SELS

Aufreinigung: Affinity purified

Immunogen: SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SELS Blocking Peptide, catalog no. 33R-7030, is also available for use as a blocking control in assays to test for specificity of this SELS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Selenoprotein S

Target: Selenoprotein S (SELS)

Andere Bezeichnung: SELS (SELS Produkte)

Synonyme: ADO15 antikoerper, SBBI8 antikoerper, SELS antikoerper, SEPS1 antikoerper, 1500011E07Rik antikoerper, C78786 antikoerper, H-4 antikoerper, H-47 antikoerper, H4 antikoerper, H47 antikoerper, Sels antikoerper, sg2 antikoerper, selenoprotein S antikoerper, SELENOS antikoerper, Selenos antikoerper

Hintergrund: SELS is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Cell RedoxHomeostasis, Negative Regulation of intrinsic apoptotic Signaling, SARS-CoV-2 Protein Interaktom