ADAM33 Antikörper (Middle Region)

Produktnummer ABIN634549

Produktdetails anti-ADAM33 Antikörper

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADAM33 antibody was raised against the middle region of ADAM33

Aufreinigung: Affinity purified

Immunogen: ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM33 Blocking Peptide, catalog no. 33R-3711, is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM33

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Andere Bezeichnung: ADAM33 (ADAM33 Produkte)

Synonyme: ADAM13 antikoerper, ADAM33 antikoerper, Adaml antikoerper, adam13 antikoerper, C20orf153 antikoerper, DJ964F7.1 antikoerper, ADAM metallopeptidase domain 33 antikoerper, disintegrin and metalloproteinase domain-containing protein 19-like antikoerper, a disintegrin and metallopeptidase domain 33 antikoerper, ADAM metallopeptidase domain 33 L homeolog antikoerper, ADAM33 antikoerper, LOC100230755 antikoerper, Adam33 antikoerper, adam33.L antikoerper

Hintergrund: ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

Molekulargewicht: 62 kDa (MW of target protein)