Tetraspanin 6 Antikörper (N-Term)

Produktnummer ABIN634550

Produktdetails anti-Tetraspanin 6 Antikörper

Target: Tetraspanin 6 (TSPAN6)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 6 antibody was raised against the N terminal of TSPAN6

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 6 Blocking Peptide, catalog no. 33R-9562, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 6

Target: Tetraspanin 6 (TSPAN6)

Andere Bezeichnung: Tetraspanin 6 (TSPAN6 Produkte)

Synonyme: GB14865 antikoerper, TSPAN6 antikoerper, t245 antikoerper, tm4sf6 antikoerper, tspan-6 antikoerper, DKFZp469J2433 antikoerper, TM4SF6 antikoerper, T245 antikoerper, TSPAN-6 antikoerper, 6720473L21Rik antikoerper, AI316786 antikoerper, Tm4sf antikoerper, Tm4sf6 antikoerper, tetraspanin 6 antikoerper, TSPAN6 antikoerper, Tspan6 antikoerper, tspan6 antikoerper

Hintergrund: TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2.

Molekulargewicht: 27 kDa (MW of target protein)