HFE Antikörper (N-Term)

Produktnummer ABIN634556

Produktdetails anti-HFE Antikörper

Target: HFE (Hemochromatosis (HFE))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HFE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HFE antibody was raised against the N terminal of HFE

Aufreinigung: Affinity purified

Immunogen: HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HFE Blocking Peptide, catalog no. 33R-6012, is also available for use as a blocking control in assays to test for specificity of this HFE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HFE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HFE

Target: HFE (Hemochromatosis (HFE))

Andere Bezeichnung: HFE (HFE Produkte)

Synonyme: HFE1 antikoerper, HH antikoerper, HLA-H antikoerper, MVCD7 antikoerper, TFQTL2 antikoerper, MR2 antikoerper, hemochromatosis antikoerper, HFE antikoerper, Hfe antikoerper

Hintergrund: HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process