SLC20A1 Antikörper
-
- Target Alle SLC20A1 Antikörper anzeigen
- SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC20A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC20 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
- Top Product
- Discover our top product SLC20A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC20A1 Blocking Peptide, catalog no. 33R-5497, is also available for use as a blocking control in assays to test for specificity of this SLC20A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))
- Andere Bezeichnung
- SLC20A1 (SLC20A1 Produkte)
- Synonyme
- SLC20A1 antikoerper, DKFZp459N1424 antikoerper, Glvr-1 antikoerper, pit1 antikoerper, slc20a1 antikoerper, xSLC20A1 antikoerper, GLVR1 antikoerper, PIT1 antikoerper, PiT-1 antikoerper, AI607883 antikoerper, Glvr1 antikoerper, solute carrier family 20 member 1 antikoerper, solute carrier family 20 member 1 L homeolog antikoerper, solute carrier family 20, member 1 antikoerper, SLC20A1 antikoerper, slc20a1.L antikoerper, Slc20a1 antikoerper
- Hintergrund
- Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.
- Molekulargewicht
- 74 kDa (MW of target protein)
-