FcRn Antikörper (N-Term)

Produktnummer ABIN634564

Produktdetails anti-FcRn Antikörper

Target: FcRn (IgG receptor FcRn (FcRn))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FcRn Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FCGRT antibody was raised against the N terminal of FCGRT

Aufreinigung: Affinity purified

Immunogen: FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCGRT Blocking Peptide, catalog no. 33R-3667, is also available for use as a blocking control in assays to test for specificity of this FCGRT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCGRT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FcRn

Target: FcRn (IgG receptor FcRn (FcRn))

Andere Bezeichnung: FCGRT (FcRn Produkte)

Synonyme: FCRN antikoerper, alpha-chain antikoerper, FcRn antikoerper, Fc fragment of IgG receptor and transporter antikoerper, Fc receptor, IgG, alpha chain transporter antikoerper, FCGRT antikoerper, Fcgrt antikoerper

Hintergrund: FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process