EPOR Antikörper (N-Term)
-
- Target Alle EPOR Antikörper anzeigen
- EPOR (Erythropoietin Receptor (EPOR))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPOR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EPOr antibody was raised against the N terminal of EPOR
- Aufreinigung
- Affinity purified
- Immunogen
- EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL
- Top Product
- Discover our top product EPOR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EPOr Blocking Peptide, catalog no. 33R-1978, is also available for use as a blocking control in assays to test for specificity of this EPOr antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPOR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPOR (Erythropoietin Receptor (EPOR))
- Andere Bezeichnung
- EPOr (EPOR Produkte)
- Synonyme
- EPOR antikoerper, epor antikoerper, EPO-R antikoerper, erythropoietin receptor antikoerper, erythropoietin receptor L homeolog antikoerper, EPOR antikoerper, epor antikoerper, Epor antikoerper, epor.L antikoerper
- Hintergrund
- The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg
-