IL-22 Antikörper (C-Term)

Produktnummer ABIN634575

Produktdetails anti-IL-22 Antikörper

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IL22 antibody was raised against the C terminal of IL22

Aufreinigung: Affinity purified

Immunogen: IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL22 Blocking Peptide, catalog no. 33R-1709, is also available for use as a blocking control in assays to test for specificity of this IL22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-22

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Andere Bezeichnung: IL22 (IL22 Produkte)

Synonyme: IL-21 antikoerper, IL-22 antikoerper, IL-D110 antikoerper, IL-TIF antikoerper, ILTIF antikoerper, TIFIL-23 antikoerper, TIFa antikoerper, zcyto18 antikoerper, IL-22a antikoerper, ILTIFa antikoerper, Iltif antikoerper, RGD1561292 antikoerper, interleukin-22 antikoerper, interleukin 22 antikoerper, IL22 antikoerper, il22 antikoerper, Il22 antikoerper

Hintergrund: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.

Molekulargewicht: 20 kDa (MW of target protein)