CALCRL Antikörper (N-Term)

Produktnummer ABIN634576

Produktdetails anti-CALCRL Antikörper

Target: CALCRL (Calcitonin Receptor-Like (CALCRL))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CALCRL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CALCRL antibody was raised against the N terminal of CALCRL

Aufreinigung: Affinity purified

Immunogen: CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CALCRL Blocking Peptide, catalog no. 33R-1962, is also available for use as a blocking control in assays to test for specificity of this CALCRL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALCRL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CALCRL

Target: CALCRL (Calcitonin Receptor-Like (CALCRL))

Andere Bezeichnung: CALCRL (CALCRL Produkte)

Hintergrund: CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: cAMP Metabolic Process