CALCRL Antikörper (N-Term)
-
- Target Alle CALCRL Antikörper anzeigen
- CALCRL (Calcitonin Receptor-Like (CALCRL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CALCRL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CALCRL antibody was raised against the N terminal of CALCRL
- Aufreinigung
- Affinity purified
- Immunogen
- CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
- Top Product
- Discover our top product CALCRL Primärantikörper
-
anti-Calcitonin Receptor-Like (CALCRL) (AA 522-536), (C-Term), (Intracellular) antibody
CALCRL Reaktivität: Human, Maus, Ratte WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) (AA 340-367) antibodyCALCRL Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB22070 unconjugated
anti-Calcitonin Receptor-Like (CALCRL) antibodyCALCRL Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) (Cytoplasmic Domain) antibodyCALCRL Reaktivität: Human, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Ziege, Affe, Hamster, Schwein, Xenopus laevis IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) (AA 23-132) antibodyCALCRL Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) antibodyCALCRL Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) (C-Term) antibodyCALCRL Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) (AA 392-461) antibodyCALCRL Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Calcitonin Receptor-Like (CALCRL) (AA 108-157) antibodyCALCRL Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CALCRL Blocking Peptide, catalog no. 33R-1962, is also available for use as a blocking control in assays to test for specificity of this CALCRL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALCRL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CALCRL (Calcitonin Receptor-Like (CALCRL))
- Andere Bezeichnung
- CALCRL (CALCRL Produkte)
- Synonyme
- CALCRL antikoerper, CGRPR antikoerper, CRLR antikoerper, AV071593 antikoerper, CLR antikoerper, Crlr antikoerper, RATCRLR antikoerper, RNCLR antikoerper, calcitonin receptor like receptor antikoerper, calcitonin receptor-like antikoerper, calcitonin receptor like receptor L homeolog antikoerper, CALCRL antikoerper, LOC100168906 antikoerper, calcrl antikoerper, Calcrl antikoerper, calcrl.L antikoerper
- Hintergrund
- CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-
