GHRHR Antikörper (N-Term)

Produktnummer ABIN634579

Produktdetails anti-GHRHR Antikörper

Target: GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GHRHR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GHRHR antibody was raised against the N terminal of GHRHR

Aufreinigung: Affinity purified

Immunogen: GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GHRHR Blocking Peptide, catalog no. 33R-9852, is also available for use as a blocking control in assays to test for specificity of this GHRHR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHRHR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GHRHR

Target: GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))

Andere Bezeichnung: GHRHR (GHRHR Produkte)

Synonyme: GHRFR antikoerper, GRFR antikoerper, IGHD1B antikoerper, Ghrfr antikoerper, lit antikoerper, little antikoerper, GHRHREC antikoerper, GHRH-R antikoerper, growth hormone releasing hormone receptor antikoerper, GHRHR antikoerper, Ghrhr antikoerper

Hintergrund: GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Hormone Transport, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process