-
- Target Alle TNFSF18 Antikörper anzeigen
- TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNFSF18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN
- Top Product
- Discover our top product TNFSF18 Primärantikörper
-
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (AA 101-199) antibody
TNFSF18 Reaktivität: Human, Maus WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (AA 1-177) antibodyTNFSF18 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (AA 70-199) antibodyTNFSF18 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (AA 72-199) antibodyTNFSF18 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (AA 68-177) antibodyTNFSF18 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 6F7 unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) antibodyTNFSF18 Reaktivität: Human WB, IHC (p), ELISA (Capture) Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) antibodyTNFSF18 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) antibodyTNFSF18 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) (AA 68-177) antibodyTNFSF18 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18) antibodyTNFSF18 Reaktivität: Maus ELISA, FACS Wirt: Kaninchen Chimeric YGL386 unconjugated Recombinant Antibody
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TNFSF18 Blocking Peptide, catalog no. 33R-4504, is also available for use as a blocking control in assays to test for specificity of this TNFSF18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))
- Andere Bezeichnung
- TNFSF18 (TNFSF18 Produkte)
- Synonyme
- Gitrl antikoerper, AITRL antikoerper, GITRL antikoerper, TL6 antikoerper, hGITRL antikoerper, TNLG2A antikoerper, tumor necrosis factor (ligand) superfamily, member 18 antikoerper, TNF superfamily member 18 antikoerper, Tnfsf18 antikoerper, TNFSF18 antikoerper
- Hintergrund
- TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
- Molekulargewicht
- 23 kDa (MW of target protein)
-
Sie sind hier:
