SERPINB2 Antikörper
-
- Target Alle SERPINB2 Antikörper anzeigen
- SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SERPINB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SERPINB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ
- Top Product
- Discover our top product SERPINB2 Primärantikörper
-
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) antibody
SERPINB2 Reaktivität: Human, Ratte, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (Center) antibodySERPINB2 Reaktivität: Human, Maus WB, IP, ICC, IHC (p), IF Wirt: Kaninchen Polyclonal unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (AA 154-408) antibodySERPINB2 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Maus Monoclonal A4 unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (AA 116-144) antibodySERPINB2 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB19097 unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (Internal Region) antibodySERPINB2 Reaktivität: Human, Affe WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (AA 1-100) antibodySERPINB2 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 3A9 unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (AA 154-408) antibodySERPINB2 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (AA 293-389) antibodySERPINB2 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (AA 1-415) antibodySERPINB2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Plasminogen Activator Inhibitor 2 (SERPINB2) (Internal Region) antibodySERPINB2 Reaktivität: Human, Ratte, Maus WB, IHC, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SERPINB2 Blocking Peptide, catalog no. 33R-3366, is also available for use as a blocking control in assays to test for specificity of this SERPINB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))
- Andere Bezeichnung
- SERPINB2 (SERPINB2 Produkte)
- Synonyme
- HsT1201 antikoerper, PAI antikoerper, PAI-2 antikoerper, PAI2 antikoerper, PLANH2 antikoerper, SERPINB2 antikoerper, Planh2 antikoerper, ovalbumin antikoerper, Pai2a antikoerper, serpin family B member 2 antikoerper, serpin peptidase inhibitor, clade B (ovalbumin), member 2 antikoerper, serine (or cysteine) peptidase inhibitor, clade B, member 2 antikoerper, SERPINB2 antikoerper, Serpinb2 antikoerper
- Substanzklasse
- Amino Acid
- Hintergrund
- SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Autophagie
-
