ELMO3 Antikörper (Middle Region)
-
- Target Alle ELMO3 Antikörper anzeigen
- ELMO3 (Engulfment and Cell Motility 3 (ELMO3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ELMO3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ELMO3 antibody was raised against the middle region of ELMO3
- Aufreinigung
- Affinity purified
- Immunogen
- ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED
- Top Product
- Discover our top product ELMO3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ELMO3 Blocking Peptide, catalog no. 33R-8001, is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMO3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELMO3 (Engulfment and Cell Motility 3 (ELMO3))
- Andere Bezeichnung
- ELMO3 (ELMO3 Produkte)
- Synonyme
- TMEM208 antikoerper, ELMO3 antikoerper, CED-12 antikoerper, CED12 antikoerper, ELMO-3 antikoerper, 9930107J06 antikoerper, BC058752 antikoerper, Ced12 antikoerper, transmembrane protein 208 antikoerper, engulfment and cell motility 3 antikoerper, TMEM208 antikoerper, ELMO3 antikoerper, elmo3 antikoerper, Elmo3 antikoerper
- Hintergrund
- ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.
- Molekulargewicht
- 87 kDa (MW of target protein)
-