Symplekin Antikörper (N-Term)

Produktnummer ABIN634602

Produktdetails anti-Symplekin Antikörper

Target: Symplekin (SYMPK)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Symplekin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Symplekin antibody was raised against the N terminal of SYMPK

Aufreinigung: Affinity purified

Immunogen: Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Symplekin Blocking Peptide, catalog no. 33R-8224, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Symplekin

Target: Symplekin (SYMPK)

Andere Bezeichnung: Symplekin (SYMPK Produkte)

Synonyme: SPK antikoerper, SYM antikoerper, CG2097 antikoerper, Dmel\\CG2097 antikoerper, dSymp antikoerper, 1500016F02Rik antikoerper, 4632415H16Rik antikoerper, AA125406 antikoerper, AI449890 antikoerper, Hfn3g antikoerper, sympk antikoerper, MGC75595 antikoerper, SYMPK antikoerper, T22C5.3 antikoerper, DKFZp468C0711 antikoerper, symplekin antikoerper, Symplekin antikoerper, symplekin S homeolog antikoerper, SYMPK antikoerper, Sym antikoerper, Sympk antikoerper, sympk.S antikoerper, sympk antikoerper, LOC552752 antikoerper, AT1G27595 antikoerper, LOC5580150 antikoerper, CpipJ_CPIJ011126 antikoerper, Bm1_50390 antikoerper, NAEGRDRAFT_80124 antikoerper, LOAG_00841 antikoerper

Hintergrund: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

Molekulargewicht: 141 kDa (MW of target protein)