Symplekin Antikörper (N-Term)

Produktnummer ABIN634602

Produktdetails anti-Symplekin Antikörper

Target: Symplekin (SYMPK)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Symplekin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Symplekin antibody was raised against the N terminal of SYMPK

Aufreinigung: Affinity purified

Immunogen: Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Symplekin Blocking Peptide, catalog no. 33R-8224, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Symplekin

Target: Symplekin (SYMPK)

Andere Bezeichnung: Symplekin (SYMPK Produkte)

Hintergrund: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

Molekulargewicht: 141 kDa (MW of target protein)