Claudin 16 Antikörper (C-Term)
-
- Target Alle Claudin 16 (CLDN16) Antikörper anzeigen
- Claudin 16 (CLDN16)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Claudin 16 antibody was raised against the C terminal of CLDN16
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
- Top Product
- Discover our top product CLDN16 Primärantikörper
-
anti-Claudin 16 (CLDN16) (AA 6-33), (N-Term) antibody
CLDN16 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB30098 unconjugated
anti-Claudin 16 (CLDN16) (AA 1-73) antibodyCLDN16 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1F2 unconjugated
anti-Claudin 16 (CLDN16) (AA 1-73) antibodyCLDN16 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (AA 13-41), (N-Term) antibodyCLDN16 Reaktivität: Human WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (AA 50-150) antibodyCLDN16 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (C-Term) antibodyCLDN16 Reaktivität: Human, Maus, Schwein, Rind (Kuh), Hund, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (AA 6-33) antibodyCLDN16 Reaktivität: Human WB, FACS, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (C-Term) antibodyCLDN16 Reaktivität: Human, Maus, Schwein, Ratte, Rind (Kuh), Hund, Kaninchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 16 (CLDN16)
- Andere Bezeichnung
- Claudin 16 (CLDN16 Produkte)
- Synonyme
- CLDN16 antikoerper, HOMG3 antikoerper, PCLN1 antikoerper, claudin-16 antikoerper, Pcln1 antikoerper, claudin 16 antikoerper, CLDN16 antikoerper, Cldn16 antikoerper
- Hintergrund
- Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Hepatitis C
-
