Claudin 1 Antikörper (C-Term)

Produktnummer ABIN634607

Produktdetails anti-Claudin 1 Antikörper

Target: Claudin 1 (CLDN1)

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Claudin 1 antibody was raised against the C terminal of CLDN1

Aufreinigung: Affinity purified

Immunogen: Claudin 1 antibody was raised using the C terminal of CLDN1 corresponding to a region with amino acids GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Anwendungsinformationen

Applikationshinweise: WB: 1-5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 1 Blocking Peptide, catalog no. 33R-3488, is also available for use as a blocking control in assays to test for specificity of this Claudin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 1

Target: Claudin 1 (CLDN1)

Andere Bezeichnung: Claudin 1 (CLDN1 Produkte)

Synonyme: CLD1 antikoerper, ILVASC antikoerper, SEMP1 antikoerper, AI596271 antikoerper, cldn19 antikoerper, claudin-1 antikoerper, cld1 antikoerper, ilvasc antikoerper, semp1 antikoerper, CLDN1 antikoerper, claudin 1 antikoerper, claudin 1 S homeolog antikoerper, CLDN1 antikoerper, Cldn1 antikoerper, cldn1 antikoerper, cldn1.S antikoerper

Hintergrund: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C