NPHP1 Antikörper
-
- Target Alle NPHP1 Antikörper anzeigen
- NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NPHP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG
- Top Product
- Discover our top product NPHP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NPHP1 Blocking Peptide, catalog no. 33R-3334, is also available for use as a blocking control in assays to test for specificity of this NPHP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPHP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))
- Andere Bezeichnung
- NPHP1 (NPHP1 Produkte)
- Hintergrund
- Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.
- Molekulargewicht
- 83 kDa (MW of target protein)
-