Annexin a10 Antikörper (Middle Region)
-
- Target Alle Annexin a10 (ANXA10) Antikörper anzeigen
- Annexin a10 (ANXA10) (Annexin A10 (ANXA10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin a10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A10 antibody was raised against the middle region of ANXA10
- Kreuzreaktivität
- Human
- Aufreinigung
- Affinity purified
- Immunogen
- Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE
- Top Product
- Discover our top product ANXA10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A10 Blocking Peptide, catalog no. 33R-9693, is also available for use as a blocking control in assays to test for specificity of this Annexin A10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin a10 (ANXA10) (Annexin A10 (ANXA10))
- Andere Bezeichnung
- Annexin A10 (ANXA10 Produkte)
- Synonyme
- ANXA10 antikoerper, ANX14 antikoerper, RGD1560956 antikoerper, annexin A10 antikoerper, ANXA10 antikoerper, anxa10 antikoerper, Anxa10 antikoerper
- Substanzklasse
- Chemical
- Hintergrund
- This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete
- Molekulargewicht
- 37 kDa (MW of target protein)
-