SSX2IP Antikörper (Middle Region)
-
- Target Alle SSX2IP Antikörper anzeigen
- SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SSX2IP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SSX2 IP antibody was raised against the middle region of SSX2 P
- Aufreinigung
- Affinity purified
- Immunogen
- SSX2 IP antibody was raised using the middle region of SSX2 P corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA
- Top Product
- Discover our top product SSX2IP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SSX2IP Blocking Peptide, catalog no. 33R-4706, is also available for use as a blocking control in assays to test for specificity of this SSX2IP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSX0 P antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSX2IP (Synovial Sarcoma, X Breakpoint 2 Interacting Protein (SSX2IP))
- Andere Bezeichnung
- SSX2IP (SSX2IP Produkte)
- Synonyme
- zgc:73314 antikoerper, MGC83757 antikoerper, ADIP antikoerper, LCG antikoerper, AU014939 antikoerper, AU042321 antikoerper, Adip antikoerper, synovial sarcoma, X breakpoint 2 interacting protein a antikoerper, synovial sarcoma, X breakpoint 2 interacting protein S homeolog antikoerper, SSX family member 2 interacting protein antikoerper, synovial sarcoma, X 2 interacting protein antikoerper, ssx2ipa antikoerper, ssx2ip.S antikoerper, SSX2IP antikoerper, Ssx2ip antikoerper
- Hintergrund
- SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.
- Molekulargewicht
- 68 kDa (MW of target protein)
-