ANXA8L2 Antikörper (N-Term)

Produktnummer ABIN634618

Produktdetails anti-ANXA8L2 Antikörper

Target: ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))

Bindungsspezifität: N-Term

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANXA8L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Annexin A8-Like 2 antibody was raised against the N terminal of ANXA8 L2

Kreuzreaktivität: Human

Aufreinigung: Affinity purified

Immunogen: Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8 L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A8-Like 2 Blocking Peptide, catalog no. 33R-7004, is also available for use as a blocking control in assays to test for specificity of this Annexin A8-Like 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANXA8L2

Target: ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))

Andere Bezeichnung: Annexin A8-Like 2 (ANXA8L2 Produkte)

Synonyme: ANXA8 antikoerper, VAC-beta antikoerper, annexin A8-like 1 antikoerper, annexin A8 like 1 antikoerper, ANXA8L1 antikoerper

Substanzklasse: Chemical

Hintergrund: ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Molekulargewicht: 37 kDa (MW of target protein)