Parvin, beta Antikörper (N-Term)

Produktnummer ABIN634620

Produktdetails anti-Parvin, beta Antikörper

Target: Parvin, beta (PARVB)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Parvin, beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PARVB antibody was raised against the N terminal of PARVB

Aufreinigung: Affinity purified

Immunogen: PARVB antibody was raised using the N terminal of PARVB corresponding to a region with amino acids LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARVB Blocking Peptide, catalog no. 33R-5302, is also available for use as a blocking control in assays to test for specificity of this PARVB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARVB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Parvin, beta

Target: Parvin, beta (PARVB)

Andere Bezeichnung: PARVB (PARVB Produkte)

Synonyme: affixin antikoerper, beta-parvin antikoerper, fd02e01 antikoerper, wu:fd02e01 antikoerper, zgc:73117 antikoerper, CGI-56 antikoerper, AI595373 antikoerper, AW742462 antikoerper, D15Gsk1 antikoerper, parvin beta antikoerper, parvin, beta antikoerper, parvin beta S homeolog antikoerper, parvb antikoerper, PARVB antikoerper, parvb.S antikoerper, Parvb antikoerper

Hintergrund: Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.

Molekulargewicht: 45 kDa (MW of target protein)