TSTA3 Antikörper (N-Term)

Produktnummer ABIN634621

Produktdetails anti-TSTA3 Antikörper

Target: TSTA3 (Tissue Specific Transplantation Antigen P35B (TSTA3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSTA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TSTA3 antibody was raised against the N terminal of TSTA3

Aufreinigung: Affinity purified

Immunogen: TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSTA3 Blocking Peptide, catalog no. 33R-6023, is also available for use as a blocking control in assays to test for specificity of this TSTA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSTA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSTA3

Target: TSTA3 (Tissue Specific Transplantation Antigen P35B (TSTA3))

Andere Bezeichnung: TSTA3 (TSTA3 Produkte)

Synonyme: FX antikoerper, P35B antikoerper, SDR4E1 antikoerper, AI256181 antikoerper, Tstap35b antikoerper, p35b antikoerper, sdr4e1 antikoerper, TSTA3 antikoerper, zgc:101805 antikoerper, si:dkey-235d18none antikoerper, Fx antikoerper, tissue specific transplantation antigen P35B antikoerper, tissue specific transplantation antigen P35B L homeolog antikoerper, TSTA3 antikoerper, Tsta3 antikoerper, tsta3 antikoerper, tsta3.L antikoerper

Hintergrund: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Molekulargewicht: 35 kDa (MW of target protein)