MYBPH Antikörper (N-Term)

Produktnummer ABIN634622

Produktdetails anti-MYBPH Antikörper

Target: MYBPH (Myosin Binding Protein H (MYBPH))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYBPH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MYBPH antibody was raised against the N terminal of MYBPH

Aufreinigung: Affinity purified

Immunogen: MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYBPH Blocking Peptide, catalog no. 33R-4913, is also available for use as a blocking control in assays to test for specificity of this MYBPH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYBPH

Target: MYBPH (Myosin Binding Protein H (MYBPH))

Andere Bezeichnung: MYBPH (MYBPH Produkte)

Synonyme: MGC64588 antikoerper, MYBPH antikoerper, MGC143401 antikoerper, MGC108122 antikoerper, AI385643 antikoerper, MyBP-H antikoerper, myosin binding protein H S homeolog antikoerper, myosin binding protein H antikoerper, mybph.S antikoerper, MYBPH antikoerper, mybph antikoerper, Mybph antikoerper

Hintergrund: MYBPH binds to myosin, probably involved in interaction with thick myofilaments in the A-band.

Molekulargewicht: 52 kDa (MW of target protein)