PNN Antikörper (N-Term)
-
- Target Alle PNN Antikörper anzeigen
- PNN (Pinin, Desmosome Associated Protein (PNN))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PNN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PNN antibody was raised against the N terminal of PNN
- Aufreinigung
- Affinity purified
- Immunogen
- PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
- Top Product
- Discover our top product PNN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PNN Blocking Peptide, catalog no. 33R-5794, is also available for use as a blocking control in assays to test for specificity of this PNN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNN (Pinin, Desmosome Associated Protein (PNN))
- Andere Bezeichnung
- PNN (PNN Produkte)
- Synonyme
- DRS antikoerper, DRSP antikoerper, SDK3 antikoerper, memA antikoerper, wu:fb24d03 antikoerper, pnn antikoerper, MGC88923 antikoerper, PNN antikoerper, AU045199 antikoerper, D12Ertd512e antikoerper, CG8383 antikoerper, Dmel\\CG8383 antikoerper, dPnn antikoerper, pinin, desmosome associated protein antikoerper, pinin antikoerper, Pinin antikoerper, PNN antikoerper, Pnn antikoerper, pnn antikoerper, LOC100380709 antikoerper
- Hintergrund
- PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene, the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression.
- Molekulargewicht
- 81 kDa (MW of target protein)
-