ADAM12 Antikörper
-
- Target Alle ADAM12 Antikörper anzeigen
- ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAM12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE
- Top Product
- Discover our top product ADAM12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAM12 Blocking Peptide, catalog no. 33R-9503, is also available for use as a blocking control in assays to test for specificity of this ADAM12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))
- Andere Bezeichnung
- ADAM12 (ADAM12 Produkte)
- Synonyme
- ADAM12 antikoerper, adam12 antikoerper, Mltna antikoerper, mKIAA4001 antikoerper, MCMP antikoerper, MCMPMltna antikoerper, MLTN antikoerper, MLTNA antikoerper, ADAM metallopeptidase domain 12 antikoerper, a disintegrin and metallopeptidase domain 12 (meltrin alpha) antikoerper, ADAM12 antikoerper, adam12 antikoerper, Adam12 antikoerper
- Hintergrund
- ADAM12 is a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-