Periostin Antikörper (N-Term)
-
- Target Alle Periostin (POSTN) Antikörper anzeigen
- Periostin (POSTN)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Periostin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POSTN antibody was raised against the N terminal of POSTN
- Aufreinigung
- Affinity purified
- Immunogen
- POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
- Top Product
- Discover our top product POSTN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POSTN Blocking Peptide, catalog no. 33R-7797, is also available for use as a blocking control in assays to test for specificity of this POSTN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POSTN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Periostin (POSTN)
- Andere Bezeichnung
- POSTN (POSTN Produkte)
- Synonyme
- fa99h07 antikoerper, pn antikoerper, postn antikoerper, wu:fa99h07 antikoerper, wu:fc70f09 antikoerper, zgc:153873 antikoerper, LOC100008945 antikoerper, osf-2 antikoerper, pdlpostn antikoerper, periostin antikoerper, OSF-2 antikoerper, OSF2 antikoerper, PDLPOSTN antikoerper, PN antikoerper, RP11-412K4.1 antikoerper, A630052E07Rik antikoerper, AI747096 antikoerper, Osf2 antikoerper, PLF antikoerper, peri antikoerper, Plf antikoerper, periostin antikoerper, periostin, osteoblast specific factor b antikoerper, periostin, osteoblast specific factor antikoerper, POSTN antikoerper, postnb antikoerper, postn antikoerper, Postn antikoerper
- Hintergrund
- POSTN binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.
- Molekulargewicht
- 93 kDa (MW of target protein)
-