MFAP4 Antikörper (N-Term)
-
- Target Alle MFAP4 Antikörper anzeigen
- MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MFAP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MFAP4 antibody was raised against the N terminal of MFAP4
- Aufreinigung
- Affinity purified
- Immunogen
- MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
- Top Product
- Discover our top product MFAP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MFAP4 Blocking Peptide, catalog no. 33R-9037, is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))
- Andere Bezeichnung
- MFAP4 (MFAP4 Produkte)
- Hintergrund
- MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.
- Molekulargewicht
- 29 kDa (MW of target protein)
-