Osteomodulin Antikörper (Middle Region)
-
- Target Alle Osteomodulin (OMD) Antikörper anzeigen
- Osteomodulin (OMD)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Osteomodulin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Osteomodulin antibody was raised against the middle region of OMD
- Aufreinigung
- Affinity purified
- Immunogen
- Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD
- Top Product
- Discover our top product OMD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Osteomodulin (OMD)
- Andere Bezeichnung
- Osteomodulin (OMD Produkte)
- Synonyme
- si:ch211-103f16.5 antikoerper, OMD antikoerper, OSAD antikoerper, SLRR2C antikoerper, osteomodulin antikoerper, omd antikoerper, OMD antikoerper, Omd antikoerper
- Hintergrund
- OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-