Laminin beta 3 Antikörper (Middle Region)
-
- Target Alle Laminin beta 3 (LAMB3) Antikörper anzeigen
- Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Laminin beta 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Laminin Beta 3 antibody was raised against the middle region of LAMB3
- Aufreinigung
- Affinity purified
- Immunogen
- Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
- Top Product
- Discover our top product LAMB3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Laminin Beta 3 Blocking Peptide, catalog no. 33R-2696, is also available for use as a blocking control in assays to test for specificity of this Laminin Beta 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))
- Andere Bezeichnung
- Laminin beta 3 (LAMB3 Produkte)
- Synonyme
- LAMB3 antikoerper, lam5 antikoerper, lamnb1 antikoerper, BM600-125KDA antikoerper, LAM5 antikoerper, LAMNB1 antikoerper, laminin subunit beta 3 antikoerper, laminin, beta 3 antikoerper, LAMB3 antikoerper, lamb3 antikoerper, Lamb3 antikoerper
- Hintergrund
- The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.
- Molekulargewicht
- 128 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-