SPON2 Antikörper (N-Term)

Produktnummer ABIN634656

Produktdetails anti-SPON2 Antikörper

Target: SPON2 (Spondin 2 (SPON2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPON2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPON2 antibody was raised against the N terminal of SPON2

Aufreinigung: Affinity purified

Immunogen: SPON2 antibody was raised using the N terminal of SPON2 corresponding to a region with amino acids CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPON2 Blocking Peptide, catalog no. 33R-1803, is also available for use as a blocking control in assays to test for specificity of this SPON2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPON2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPON2

Target: SPON2 (Spondin 2 (SPON2))

Andere Bezeichnung: SPON2 (SPON2 Produkte)

Synonyme: DIL-1 antikoerper, DIL1 antikoerper, M-SPONDIN antikoerper, MINDIN antikoerper, 2310045I24Rik antikoerper, AI504350 antikoerper, M-spondin antikoerper, Mindin antikoerper, Mspondin antikoerper, etID309958.14 antikoerper, mindin2 antikoerper, zgc:100756 antikoerper, mindin1 antikoerper, spondin 2 antikoerper, spondin 2, extracellular matrix protein antikoerper, spondin 2, extracellular matrix protein S homeolog antikoerper, spondin 2b, extracellular matrix protein antikoerper, spondin 2a, extracellular matrix protein antikoerper, SPON2 antikoerper, Spon2 antikoerper, spon2.S antikoerper, spon2b antikoerper, spon2a antikoerper

Hintergrund: SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.

Molekulargewicht: 36 kDa (MW of target protein)