AZGP1 Antikörper (N-Term)
-
- Target Alle AZGP1 Antikörper anzeigen
- AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AZGP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AZGP1 antibody was raised against the N terminal of AZGP1
- Aufreinigung
- Affinity purified
- Immunogen
- AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
- Top Product
- Discover our top product AZGP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AZGP1 Blocking Peptide, catalog no. 33R-4700, is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AZGP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))
- Andere Bezeichnung
- AZGP1 (AZGP1 Produkte)
- Synonyme
- Zag antikoerper, ZA2G antikoerper, ZAG antikoerper, ZA2GA antikoerper, Zna2gp antikoerper, alpha-2-glycoprotein 1, zinc antikoerper, alpha-2-glycoprotein 1, zinc-binding antikoerper, Azgp1 antikoerper, AZGP1 antikoerper
- Hintergrund
- Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-