MICA Antikörper (N-Term)
-
- Target Alle MICA Antikörper anzeigen
- MICA (MHC Class I Polypeptide-Related Sequence A (MICA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MICA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MICA antibody was raised against the N terminal of MICA
- Aufreinigung
- Affinity purified
- Immunogen
- MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ
- Top Product
- Discover our top product MICA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MICA Blocking Peptide, catalog no. 33R-5029, is also available for use as a blocking control in assays to test for specificity of this MICA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MICA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MICA (MHC Class I Polypeptide-Related Sequence A (MICA))
- Andere Bezeichnung
- MICA (MICA Produkte)
- Synonyme
- MIC-A antikoerper, PERB11.1 antikoerper, MHC class I polypeptide-related sequence A antikoerper, MICA antikoerper
- Hintergrund
- MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Transition Metal Ion Homeostasis, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
-