Osteopontin Antikörper
-
- Target Alle Osteopontin (SPP1) Antikörper anzeigen
- Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Osteopontin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ
- Top Product
- Discover our top product SPP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPP1 Blocking Peptide, catalog no. 33R-6363, is also available for use as a blocking control in assays to test for specificity of this SPP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))
- Andere Bezeichnung
- SPP1 (SPP1 Produkte)
- Synonyme
- BNSP antikoerper, BSPI antikoerper, ETA-1 antikoerper, OPN antikoerper, 2AR antikoerper, Apl-1 antikoerper, Bsp antikoerper, Eta antikoerper, OP antikoerper, Opn antikoerper, Opnl antikoerper, Ric antikoerper, Spp-1 antikoerper, OSP antikoerper, zgc:111821 antikoerper, secreted phosphoprotein 1 antikoerper, SPP1 antikoerper, Spp1 antikoerper, spp1 antikoerper
- Hintergrund
- The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-