KIT Ligand Antikörper (Middle Region)
-
- Target Alle KIT Ligand (KITLG) Antikörper anzeigen
- KIT Ligand (KITLG)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIT Ligand Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KITLG antibody was raised against the middle region of KITLG
- Aufreinigung
- Affinity purified
- Immunogen
- KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
- Top Product
- Discover our top product KITLG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KITLG Blocking Peptide, catalog no. 33R-9145, is also available for use as a blocking control in assays to test for specificity of this KITLG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIT Ligand (KITLG)
- Andere Bezeichnung
- KITLG (KITLG Produkte)
- Hintergrund
- KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung
-