Astrotactin 2 Antikörper (N-Term)

Produktnummer ABIN634672

Produktdetails anti-Astrotactin 2 Antikörper

Target: Astrotactin 2 (ASTN2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Astrotactin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Astrotactin 2 antibody was raised against the N terminal of ASTN2

Aufreinigung: Affinity purified

Immunogen: Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Astrotactin 2 Blocking Peptide, catalog no. 33R-7131, is also available for use as a blocking control in assays to test for specificity of this Astrotactin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASTN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Astrotactin 2

Target: Astrotactin 2 (ASTN2)

Andere Bezeichnung: Astrotactin 2 (ASTN2 Produkte)

Synonyme: bA67K19.1 antikoerper, ASTN2 antikoerper, 1d8 antikoerper, Astnl antikoerper, bM452J22.1 antikoerper, astrotactin 2 antikoerper, astrotactin-2 antikoerper, ASTN2 antikoerper, LOC702370 antikoerper, astn2 antikoerper, Astn2 antikoerper

Hintergrund: ASTN2 may play an important role in neuronal functioning.

Molekulargewicht: 142 kDa (MW of target protein)