CD36 Antikörper
-
- Target Alle CD36 Antikörper anzeigen
- CD36
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD36 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
- Top Product
- Discover our top product CD36 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CD36 Blocking Peptide, catalog no. 33R-6013, is also available for use as a blocking control in assays to test for specificity of this CD36 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD36 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD36
- Andere Bezeichnung
- CD36 (CD36 Produkte)
- Synonyme
- BDPLT10 antikoerper, CHDS7 antikoerper, FAT antikoerper, GP3B antikoerper, GP4 antikoerper, GPIV antikoerper, PASIV antikoerper, SCARB3 antikoerper, Fat antikoerper, Scarb3 antikoerper, GPIIIB antikoerper, PAS-4 antikoerper, zgc:92513 antikoerper, CD36 molecule antikoerper, CD36 molecule (thrombospondin receptor) antikoerper, CD36 antikoerper, Cd36 antikoerper, cd36 antikoerper
- Hintergrund
- CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- TLR Signalweg, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteine
-