Desmoglein 2 Antikörper (N-Term)
-
- Target Alle Desmoglein 2 (DSG2) Antikörper anzeigen
- Desmoglein 2 (DSG2)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Desmoglein 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Desmoglein 2 antibody was raised against the N terminal of DSG2
- Aufreinigung
- Affinity purified
- Immunogen
- Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
- Top Product
- Discover our top product DSG2 Primärantikörper
-
anti-Desmoglein 2 (DSG2) (N-Term) antibody
DSG2 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Desmoglein 2 (DSG2) (AA 72-121) antibodyDSG2 Reaktivität: Human, Ratte, Maus, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Desmoglein 2 (DSG2) (N-Term) antibodyDSG2 Reaktivität: Human, Ratte, Maus, Rind (Kuh), Hund, Schwein, Meerschweinchen, Pferd, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Desmoglein 2 (DSG2) (AA 275-533) antibodyDSG2 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Desmoglein 2 (DSG2) (AA 183-331) antibodyDSG2 Reaktivität: Human ELISA, IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Desmoglein 2 (DSG2) (AA 145-216), (N-Term) antibodyDSG2 Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB16855 unconjugated
anti-Desmoglein 2 (DSG2) (AA 37-164) antibodyDSG2 Reaktivität: Human WB, IF, IP, ICC Wirt: Maus Monoclonal 10D2 unconjugated
anti-Desmoglein 2 (DSG2) (AA 51-150) antibodyDSG2 Reaktivität: Human, Ratte, Maus WB, ELISA, IHC (p), ICC, IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Desmoglein 2 (DSG2) antibodyDSG2 Reaktivität: Human WB, IF, FACS Wirt: Maus Monoclonal 6D8 unconjugated
anti-Desmoglein 2 (DSG2) (AA 829-857), (C-Term) antibodyDSG2 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Desmoglein 2 Blocking Peptide, catalog no. 33R-4430, is also available for use as a blocking control in assays to test for specificity of this Desmoglein 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSG2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Desmoglein 2 (DSG2)
- Andere Bezeichnung
- Desmoglein 2 (DSG2 Produkte)
- Hintergrund
- Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.
- Molekulargewicht
- 114 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-
