Cx40/GJA5 Antikörper (N-Term)
-
- Target Alle Cx40/GJA5 (GJA5) Antikörper anzeigen
- Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cx40/GJA5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJA5 antibody was raised against the N terminal of GJA5
- Aufreinigung
- Affinity purified
- Immunogen
- GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
- Top Product
- Discover our top product GJA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))
- Andere Bezeichnung
- GJA5 (GJA5 Produkte)
- Synonyme
- Cx40 antikoerper, 5730555N10Rik antikoerper, Cnx40 antikoerper, Gja-5 antikoerper, ATFB11 antikoerper, CX40 antikoerper, gap junction protein, alpha 5 antikoerper, gap junction protein alpha 5 antikoerper, Gja5 antikoerper, GJA5 antikoerper
- Hintergrund
- GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-