NINJ1 Antikörper (N-Term)

Produktnummer ABIN634689

Produktdetails anti-NINJ1 Antikörper

Target: NINJ1 (Ninjurin 1 (NINJ1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NINJ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ninjurin 1 antibody was raised against the N terminal of NINJ1

Aufreinigung: Affinity purified

Immunogen: Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ninjurin 1 Blocking Peptide, catalog no. 33R-2165, is also available for use as a blocking control in assays to test for specificity of this Ninjurin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NINJ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NINJ1

Target: NINJ1 (Ninjurin 1 (NINJ1))

Andere Bezeichnung: Ninjurin 1 (NINJ1 Produkte)

Synonyme: nin1 antikoerper, MGC79511 antikoerper, ninjurin antikoerper, NIN1 antikoerper, NINJURIN antikoerper, AU024536 antikoerper, ninjurin 1 antikoerper, ninjurin 1 L homeolog antikoerper, NINJ1 antikoerper, ninj1 antikoerper, ninj1.L antikoerper, Ninj1 antikoerper

Hintergrund: NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues.

Molekulargewicht: 16 kDa (MW of target protein)