LSAMP Antikörper (N-Term)

Produktnummer ABIN634691

Produktdetails anti-LSAMP Antikörper

Target: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSAMP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LSAMP antibody was raised against the N terminal of LSAMP

Aufreinigung: Affinity purified

Immunogen: LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSAMP Blocking Peptide, catalog no. 33R-6605, is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSAMP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSAMP

Target: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Andere Bezeichnung: LSAMP (LSAMP Produkte)

Synonyme: chLAMP antikoerper, IGLON3 antikoerper, LAMP antikoerper, 5430428I19 antikoerper, AW046674 antikoerper, B130007O04Rik antikoerper, D930023J12Rik antikoerper, Lam antikoerper, Lamp antikoerper, limbic system-associated membrane protein antikoerper, LSAMP antikoerper, Lsamp antikoerper

Hintergrund: LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

Molekulargewicht: 37 kDa (MW of target protein)