PCDHAC2 Antikörper (N-Term)

Produktnummer ABIN634694

Produktdetails anti-PCDHAC2 Antikörper

Target: PCDHAC2 (Protocadherin alpha Subfamily C, 2 (PCDHAC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHAC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHAC2 antibody was raised against the N terminal of PCDHAC2

Aufreinigung: Affinity purified

Immunogen: PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHAC2 Blocking Peptide, catalog no. 33R-8663, is also available for use as a blocking control in assays to test for specificity of this PCDHAC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHAC2

Target: PCDHAC2 (Protocadherin alpha Subfamily C, 2 (PCDHAC2))

Andere Bezeichnung: PCDHAC2 (PCDHAC2 Produkte)

Synonyme: PCDH-ALPHA-C2 antikoerper, CNRc2 antikoerper, rCNRvc2 antikoerper, CNRC02 antikoerper, PCHD antikoerper, protocadherin alpha subfamily C, 2 antikoerper, PCDHAC2 antikoerper, Pcdhac2 antikoerper, pcdhac2 antikoerper

Hintergrund: PCDHAC2 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 105 kDa (MW of target protein)