CSGALNACT1 Antikörper (C-Term)
-
- Target Alle CSGALNACT1 Antikörper anzeigen
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSGALNACT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHGN antibody was raised against the C terminal Of Chgn
- Aufreinigung
- Affinity purified
- Immunogen
- CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT
- Top Product
- Discover our top product CSGALNACT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHGN Blocking Peptide, catalog no. 33R-1910, is also available for use as a blocking control in assays to test for specificity of this CHGN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
- Andere Bezeichnung
- CHGN (CSGALNACT1 Produkte)
- Synonyme
- CSGalNAcT-1 antikoerper, ChGn antikoerper, beta4GalNAcT antikoerper, CHGN antikoerper, 4732435N03Rik antikoerper, Chgn antikoerper, RGD1307618 antikoerper, chondroitin sulfate N-acetylgalactosaminyltransferase 1 antikoerper, CSGALNACT1 antikoerper, csgalnact1 antikoerper, Csgalnact1 antikoerper, LOC100517735 antikoerper
- Hintergrund
- ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-