CNTNAP4 Antikörper (N-Term)

Produktnummer ABIN634701

Produktdetails anti-CNTNAP4 Antikörper

Target: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNTNAP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CNTNAP4 antibody was raised against the N terminal of CNTNAP4

Aufreinigung: Affinity purified

Immunogen: CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNTNAP4 Blocking Peptide, catalog no. 33R-4529, is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNTNAP4

Target: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Andere Bezeichnung: CNTNAP4 (CNTNAP4 Produkte)

Synonyme: CNTNAP4 antikoerper, CNTNAP5 antikoerper, cntnap4 antikoerper, CASPR4 antikoerper, Caspr4 antikoerper, E130114F09Rik antikoerper, contactin associated protein like 4 antikoerper, contactin-associated protein-like 3 antikoerper, contactin-associated protein-like 4 antikoerper, contactin associated protein like 3 antikoerper, contactin associated protein-like 4 antikoerper, CNTNAP4 antikoerper, LOC100064076 antikoerper, LOC100472293 antikoerper, cntnap3 antikoerper, cntnap4 antikoerper, Cntnap4 antikoerper

Hintergrund: CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.

Molekulargewicht: 145 kDa (MW of target protein)