CNTNAP4 Antikörper (N-Term)
-
- Target Alle CNTNAP4 Antikörper anzeigen
- CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CNTNAP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CNTNAP4 antibody was raised against the N terminal of CNTNAP4
- Aufreinigung
- Affinity purified
- Immunogen
- CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE
- Top Product
- Discover our top product CNTNAP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CNTNAP4 Blocking Peptide, catalog no. 33R-4529, is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))
- Andere Bezeichnung
- CNTNAP4 (CNTNAP4 Produkte)
- Hintergrund
- CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.
- Molekulargewicht
- 145 kDa (MW of target protein)
-