Desmocollin 3 Antikörper (N-Term)
-
- Target Alle Desmocollin 3 (DSC3) Antikörper anzeigen
- Desmocollin 3 (DSC3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Desmocollin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Desmocollin 3 antibody was raised against the N terminal of DSC3
- Aufreinigung
- Affinity purified
- Immunogen
- Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG
- Top Product
- Discover our top product DSC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Desmocollin 3 Blocking Peptide, catalog no. 33R-6324, is also available for use as a blocking control in assays to test for specificity of this Desmocollin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Desmocollin 3 (DSC3)
- Andere Bezeichnung
- Desmocollin 3 (DSC3 Produkte)
- Hintergrund
- DSC3 is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation.
- Molekulargewicht
- 85 kDa (MW of target protein)
-