Desmocollin 3 Antikörper (N-Term)
-
- Target Alle Desmocollin 3 (DSC3) Antikörper anzeigen
- Desmocollin 3 (DSC3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Desmocollin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Desmocollin 3 antibody was raised against the N terminal of DSC3
- Aufreinigung
- Affinity purified
- Immunogen
- Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG
- Top Product
- Discover our top product DSC3 Primärantikörper
-
anti-Desmocollin 3 (DSC3) (AA 712-896) antibody
DSC3 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Desmocollin 3 (DSC3) (AA 585-684) antibodyDSC3 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4D2 unconjugated
anti-Desmocollin 3 (DSC3) (AA 822-850) antibodyDSC3 Reaktivität: Human, Maus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Desmocollin 3 (DSC3) (AA 822-850), (C-Term) antibodyDSC3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB35307 unconjugated
anti-Desmocollin 3 (DSC3) (AA 585-684) antibodyDSC3 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Desmocollin 3 (DSC3) (AA 144-193) antibodyDSC3 Reaktivität: Human, Maus, Rind (Kuh) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Desmocollin 3 Blocking Peptide, catalog no. 33R-6324, is also available for use as a blocking control in assays to test for specificity of this Desmocollin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Desmocollin 3 (DSC3)
- Andere Bezeichnung
- Desmocollin 3 (DSC3 Produkte)
- Synonyme
- CDHF3 antikoerper, DSC antikoerper, DSC1 antikoerper, DSC2 antikoerper, DSC4 antikoerper, HT-CP antikoerper, 5430426I24Rik antikoerper, MGC85083 antikoerper, desmocollin 3 antikoerper, desmocollin 3 S homeolog antikoerper, DSC3 antikoerper, Dsc3 antikoerper, dsc3.S antikoerper, dsc3 antikoerper
- Hintergrund
- DSC3 is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation.
- Molekulargewicht
- 85 kDa (MW of target protein)
-
