Cadherin 24 Antikörper (N-Term)
-
- Target Alle Cadherin 24 (CDH24) Antikörper anzeigen
- Cadherin 24 (CDH24)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cadherin 24 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDH24 antibody was raised against the N terminal of CDH24
- Aufreinigung
- Affinity purified
- Immunogen
- CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG
- Top Product
- Discover our top product CDH24 Primärantikörper
-
anti-Cadherin 24 (CDH24) (AA 54-81), (N-Term) antibody
CDH24 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB31982 unconjugated
anti-Cadherin 24 (CDH24) (AA 81-130) antibodyCDH24 Reaktivität: Human, Maus ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 24 (CDH24) (N-Term) antibodyCDH24 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio), Hund, Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cadherin 24 (CDH24) antibodyCDH24 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDH24 Blocking Peptide, catalog no. 33R-6825, is also available for use as a blocking control in assays to test for specificity of this CDH24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cadherin 24 (CDH24)
- Andere Bezeichnung
- CDH24 (CDH24 Produkte)
- Synonyme
- CDH11L antikoerper, 1700040A22Rik antikoerper, ENSMUSG00000022188 antikoerper, RGD1560161 antikoerper, cdh24 antikoerper, cadherin 24 antikoerper, cadherin-like 24 antikoerper, cadherin-24 antikoerper, CDH24 antikoerper, Cdh24 antikoerper, LOC100007192 antikoerper
- Hintergrund
- Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.
- Molekulargewicht
- 88 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-
