MPZL2 Antikörper (N-Term)

Produktnummer ABIN634708

Produktdetails anti-MPZL2 Antikörper

Target: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPZL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPZL2 antibody was raised against the N terminal of MPZL2

Aufreinigung: Affinity purified

Immunogen: MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPZL2 Blocking Peptide, catalog no. 33R-4881, is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPZL2

Target: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Andere Bezeichnung: MPZL2 (MPZL2 Produkte)

Synonyme: cb837 antikoerper, eva1 antikoerper, mpzl2 antikoerper, wu:fb07b02 antikoerper, EVA1 antikoerper, EVA antikoerper, Eva antikoerper, Eva1 antikoerper, myelin protein zero-like 2b antikoerper, myelin protein zero like 2 antikoerper, myelin protein zero-like 2 antikoerper, mpzl2b antikoerper, MPZL2 antikoerper, Mpzl2 antikoerper

Hintergrund: Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.

Molekulargewicht: 22 kDa (MW of target protein)