Claudin 5 Antikörper

Produktnummer ABIN634710

Produktdetails anti-Claudin 5 Antikörper

Target: Claudin 5 (CLDN5)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 5 Blocking Peptide, catalog no. 33R-3663, is also available for use as a blocking control in assays to test for specificity of this Claudin 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 5

Target: Claudin 5 (CLDN5)

Andere Bezeichnung: Claudin 5 (CLDN5 Produkte)

Synonyme: AWAL antikoerper, BEC1 antikoerper, CPETRL1 antikoerper, TMVCF antikoerper, cld5 antikoerper, awal antikoerper, bec1 antikoerper, claudin-5 antikoerper, cpetrl1 antikoerper, tmvcf antikoerper, AI854493 antikoerper, MBEC1 antikoerper, Tmvcf antikoerper, cldn5 antikoerper, zgc:85723 antikoerper, zgc:103419 antikoerper, claudin 5 antikoerper, Claudin-5 antikoerper, claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) antikoerper, claudin 5a antikoerper, claudin 5b antikoerper, claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog antikoerper, CLDN5 antikoerper, cld5 antikoerper, cldn5 antikoerper, Cldn5 antikoerper, cldn5a antikoerper, cldn5b antikoerper, cldn5.L antikoerper

Hintergrund: CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Hepatitis C