Protocadherin gamma Subfamily C, 3 (PCDHGC3) (N-Term) Antikörper
-
- Target Alle Protocadherin gamma Subfamily C, 3 (PCDHGC3) Antikörper anzeigen
- Protocadherin gamma Subfamily C, 3 (PCDHGC3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCDHGC3 antibody was raised against the N terminal of PCDHGC3
- Aufreinigung
- Affinity purified
- Immunogen
- PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY
- Top Product
- Discover our top product PCDHGC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCDHGC3 Blocking Peptide, catalog no. 33R-4148, is also available for use as a blocking control in assays to test for specificity of this PCDHGC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Protocadherin gamma Subfamily C, 3 (PCDHGC3)
- Andere Bezeichnung
- PCDHGC3 (PCDHGC3 Produkte)
- Hintergrund
- This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. PCDHGC3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Molekulargewicht
- 91 kDa (MW of target protein)
-