Protocadherin gamma Subfamily C, 3 (PCDHGC3) (N-Term) Antikörper

Produktnummer ABIN634711

Produktdetails

Target: Protocadherin gamma Subfamily C, 3 (PCDHGC3)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHGC3 antibody was raised against the N terminal of PCDHGC3

Aufreinigung: Affinity purified

Immunogen: PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHGC3 Blocking Peptide, catalog no. 33R-4148, is also available for use as a blocking control in assays to test for specificity of this PCDHGC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Protocadherin gamma Subfamily C, 3 (PCDHGC3)

Andere Bezeichnung: PCDHGC3 (PCDHGC3 Produkte)

Synonyme: PC43 antikoerper, PCDH-GAMMA-C3 antikoerper, PCDH2 antikoerper, Pcdh2 antikoerper, PCDHGA11 antikoerper, PCDHGC5 antikoerper, protocadherin gamma subfamily C, 3 antikoerper, PCDHGC3 antikoerper, Pcdhgc3 antikoerper

Hintergrund: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. PCDHGC3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 91 kDa (MW of target protein)