Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) Antikörper

Produktnummer ABIN634712

Produktdetails

Target: Protocadherin gamma Subfamily A, 4 (PCDHGA4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHGA4 antibody was raised against the N terminal of PCDHGA4

Aufreinigung: Affinity purified

Immunogen: PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHGA4 Blocking Peptide, catalog no. 33R-3205, is also available for use as a blocking control in assays to test for specificity of this PCDHGA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Protocadherin gamma Subfamily A, 4 (PCDHGA4)

Andere Bezeichnung: PCDHGA4 (PCDHGA4 Produkte)

Synonyme: PCDH-GAMMA-A4 antikoerper, Pcdhga3 antikoerper, protocadherin gamma subfamily A, 4 antikoerper, PCDHGA4 antikoerper, Pcdhga4 antikoerper

Hintergrund: PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 86 kDa (MW of target protein)